PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.148250.1
Common NameCsa_7G044900, LOC101221546
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family GeBP
Protein Properties Length: 411aa    MW: 47277.7 Da    PI: 4.9597
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.148250.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573125.91.7e-39184278397
          DUF573   3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                     ++rlwse+Dei++LqG+idf+  +g++p+ d+++f +f+k+++s++vsk+ql++K+rrLKkK+k++++k ++g++p+f k+h++k+f lskkiWg
  Cucsa.148250.1 184 INRLWSEDDEISILQGMIDFELAKGSDPYTDMNQFLDFIKENLSVDVSKNQLIDKVRRLKKKYKNNSEKGRNGDDPVFLKQHEHKSFVLSKKIWG 278
                     68********************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.1E-33185278IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MAPKRLVEDL PSAHAFSDAE EESDYETHED PEIDNLMNNS EDENEEHNQE EEEDDDEEEE  60
QEQEEEHEHE QEIRSPIISK HENSLEKDSG FVSDSDSEKT QSSPSASAFT IKPILRKLAI  120
DSSKPKKSSH KSSIDCATTA NPVCSGSKRP IENHFQGNDP NKRIKRIMNG EDIEEVKKVS  180
GSGINRLWSE DDEISILQGM IDFELAKGSD PYTDMNQFLD FIKENLSVDV SKNQLIDKVR  240
RLKKKYKNNS EKGRNGDDPV FLKQHEHKSF VLSKKIWGNE AKKKPRKQSV KASNSVSISS  300
PRVDVEARKL KEIVNNNNVE SKILPEEFLS EYPWLKASFL MENDKFRSEV VLRFVRERMP  360
LIGSEKAKEL DDKWRKLGES EMELYMKKVD LVREQCKLIM DSMRKAKRST *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6817920.0LN681792.1 Cucumis melo genomic scaffold, anchoredscaffold00034.
GenBankLN7132550.0LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011658715.10.0PREDICTED: mediator-associated protein 1-like
TrEMBLA0A0A0K1N40.0A0A0A0K1N4_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF139661119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.12e-32DNA-binding storekeeper protein-related transcriptional regulator
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]